SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023316 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023316
Domain Number 1 Region: 10-158
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.71e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00000989
Further Details:      
 
Domain Number 2 Region: 166-284
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.06e-34
Family Multidomain sulfurtransferase (rhodanese) 0.00000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023316   Gene: ENSNLEG00000014722   Transcript: ENSNLET00000031682
Sequence length 297
Comment pep:known_by_projection supercontig:Nleu1.0:GL397297.1:17016445:17026556:1 gene:ENSNLEG00000014722 transcript:ENSNLET00000031682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSQLFRALVSAQWVAEALRVPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
GHRAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDLAFIKTYEDIKENLESRRFQV
VDSRAAGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLTQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Download sequence
Identical sequences A0A2I3GA08
XP_003264758.1.23891 XP_004088482.1.23891 ENSNLEP00000023316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]