SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023319 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023319
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-18
Family V set domains (antibody variable domain-like) 0.00000546
Further Details:      
 
Domain Number 2 Region: 130-224
Classification Level Classification E-value
Superfamily Immunoglobulin 4.61e-18
Family I set domains 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023319   Gene: ENSNLEG00000013881   Transcript: ENSNLET00000031687
Sequence length 299
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11442043:11464891:-1 gene:ENSNLEG00000013881 transcript:ENSNLET00000031687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKAQAERKLLRLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRV
EWKFDQGDTTRLVCYNNKITASYEDRVTFLPSGITFKSVTREDTGTYTCMVSEEGGNSYG
EVKVKLIVLVPPSKPTVSIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST
RAFSNSSYVLNPTTGELVFDPLSAFDTGEYSCEARNGYGTPMTSNAVLMEAVERNVGVIV
AAVLVTLILLGILIFGIWFAYSRGHFDRTKKGTSSKKVIYSQPSARSEGEFKQTSSFLV
Download sequence
Identical sequences M3Z9D2
ENSNLEP00000023319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]