SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023324 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023324
Domain Number 1 Region: 48-369
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 5.25e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000145
Further Details:      
 
Domain Number 2 Region: 364-498
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.84e-31
Family Ricin B-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023324   Gene: ENSNLEG00000014277   Transcript: ENSNLET00000031692
Sequence length 504
Comment pep:known_by_projection supercontig:Nleu1.0:GL397588.1:211122:315319:1 gene:ENSNLEG00000014277 transcript:ENSNLET00000031692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQ
RKQWRVDLPPTSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALL
GKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTR
VVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIA
GGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPY
TFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFK
WYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKE
KSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKS
GGLSVEVCGPALSQQWKFSLNLQQ
Download sequence
Identical sequences ENSNLEP00000023324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]