SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023325 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023325
Domain Number 1 Region: 546-736,828-1149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-71
Family Tandem AAA-ATPase domain 0.029
Further Details:      
 
Domain Number 2 Region: 168-222
Classification Level Classification E-value
Superfamily UBA-like 0.000000998
Family UBA domain 0.038
Further Details:      
 
Domain Number 3 Region: 301-325
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000314
Family CCCH zinc finger 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023325
Domain Number - Region: 338-420
Classification Level Classification E-value
Superfamily UBC-like 0.00433
Family UBC-related 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023325   Gene: ENSNLEG00000016369   Transcript: ENSNLET00000031693
Sequence length 1387
Comment pep:known_by_projection supercontig:Nleu1.0:GL397288.1:18662413:18734793:-1 gene:ENSNLEG00000016369 transcript:ENSNLET00000031693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVRRKGKPGKGGGKGSSRGGRGGRSHTSKSHGSGGGGGGGGGGGGGGNRKASSRIWD
DGDDFCIFSESRRPSRPSNSNVSKGESRPKWKPKAKVPLQTLHMTSENQEKVKALLRDLQ
EQDADAGSERGISGEEEDDEPDCCNDERYWPAGQEPSLVPDLDPLEYAGLAPVEPYVPEF
TVSPFAVQKLSRYGFNIERCQAVLRMCDGDVGASLEHLLTQCFSETFGERMKISETVNQI
SLDECMEQRQEEAFALKSICGEKFIERIQNRVWTIGLELKYLTSRFRKSKPKESTKTVQE
NSLEICKFYLKGNCKFGSKCKFKHEVPPNQIVGRIERSVDDSHLNANEDASFLYELEIRF
SKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYDKALTFAETSEPVVYSLITLLEEES
EIVKLLMNTHHKYSVPPVNFLPVPSRTRINNPACHKPVIPNNSFVSNQIPEVEKESESEE
SDEDEGPAPVIVENESYVNLKKKISKRYDWQAKSVHAENGKICKQFRMKQASRQFQSILQ
ERQSLPAWEERETILNLLRKHQVVVISGMTGCGKTTQIPQFILDDSLNGPPEKVANIICT
QPRRISAISVAERVAKERVERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGDTAL
QGVSHIIVDEVHERTEESDFLLLVLKDIVSQRPGLQVILMSATLNAELFSEYFNSCPVIT
IPGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRL
SLHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIV
DGKHSYPPGAILVFLPGLAEIKMLYEQLQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVF
VKPPVGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDASKGMESLEDTFVSQANAL
QRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSAHNLQS
VFSRLIEPPHNDSLRASKIRLRDLGALTPDEKLTPLGYHLASLPVDVRIGKLMLFGSIFR
CLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFAFANSDYLALLRAYKGWQLSTKEGM
RASYNYCRQNFLSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDAT
GEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVRMQPKSAELKFVTKND
GYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVNVQLQR
GEFVVSLDDGWIRFVAASHQVAELVKELRCELDQLLQDKIKNPSIDLCTCPRGSRIISTI
VKLVTTQ
Download sequence
Identical sequences G1S341
ENSNLEP00000019929 ENSNLEP00000023325 XP_003262808.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]