SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023327 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023327
Domain Number 1 Region: 419-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-22
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 44-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 3 Region: 156-255
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023327   Gene: ENSNLEG00000013090   Transcript: ENSNLET00000031695
Sequence length 565
Comment pep:known_by_projection supercontig:Nleu1.0:GL397271.1:25911950:26004279:-1 gene:ENSNLEG00000013090 transcript:ENSNLET00000031695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIMSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYM
LMPDGSCSSALTCSMANCQYGCDVVKGQIRCQCPSPGLQLAPDGRTCVDVDECATGRASC
PRFRQCANTFGSYICKCHKGFDLMYIGGKYQCHDVDECSLGQYQCSSFARCYNIHGSYKC
KCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDGGHNNWIPDVRSTWWPPKTP
YIPPIITNRPTSKPTTRPTPKPIPIPTPPPPPPLPTELRTPLPPTTPERPTTRLTTIAPA
ASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFEIERGVSADDEAKDDPGVLVH
SCNFDHGLCGWIREKDNDLHWEPIRDPAGGQYLTVSAAKAPGEKAARLVLPLGRLMHSGD
LCLSFRHKVTGLHSGTLQVFVRKHGAQGAALWGRNGGHGWRQTQITLRGADIKSVIFKGE
KRRGHTGEIGLDDVSLRKGHCSEER
Download sequence
Identical sequences XP_003257500.1.23891 ENSNLEP00000023327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]