SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023331 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023331
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Spectrin repeat 4.83e-19
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 242-397
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-19
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 3 Region: 151-260
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000132
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 4 Region: 668-812
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000021
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 5 Region: 572-698
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000148
Family Spectrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023331   Gene: ENSNLEG00000026879   Transcript: ENSNLET00000031699
Sequence length 930
Comment pep:novel supercontig:Nleu1.0:GL397312.1:15155542:15196628:1 gene:ENSNLEG00000026879 transcript:ENSNLET00000031699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWCLCQDCMEEINLFSENKLQLKQMGDQLIKASNKSRAAEIDDKLNKINDRWQHLFDVI
GSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCDDQEIQKRLAEQQDLQ
RDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDRRWRNICAMSMERRMK
IEETWRLWQKFLDDYSRFEDWLKSAERTAACPNSSEVLYTSAKEELKRFEAFQRQIHERL
TQLELINKQYRRLARENRTDTASRLKQMVHEGNQRWDNLQRRVTAILRRLRHFTNQREEF
EGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTNKIDQLIVFGEQL
IQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSCTPGLEDEKEASENETDMEDP
REIQTDSWRKRGESEEPTSPQSLCHLVAPGHERSGCETPVSVDSIPLEWDHTGDVGGSSS
HEEDEEGPYYSALSGKSISDGHSWHVPDSPSCPEHHYKQMEGDRNVPPVPPASSTPYKPP
YGKLLLPPGTDGGKEGPRVLNGSPQQEDRRLAGITEQQSGAFDRWELIQAQELHNKLKIK
QNLQQLNSDISAITTWLKKTEAELEMLKMAKPPSDIQEIELRVKRLQEILKAFDTYKALV
VSVNVSSKEFLQTESPESTELQSRLCQLSLLWEAAQGTVDSWRGGLRQSLMQCQDFHQLS
QNLLLWLASAENRRQKAYVTDPKADPQALLECRRELMQLEKELVERQPQVDMLQEISNSL
LIKGHGEDYIEAEEKVHVIEKKLKQLREQVSQDLMSLQGTQNPAPPLPSFDEVDSGDQPP
ATSVPAPRGKQFRAVRTTEGEEETESRVPGSTRPQRSFLSRVIRAALPLQLLLLLLLLLA
CLLPSSEEDYSCTQANNFARSFYPMLRPPS
Download sequence
Identical sequences ENSNLEP00000023331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]