SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023354 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023354
Domain Number 1 Region: 149-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.22e-22
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 121-147
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000109
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 93-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000122
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023354   Gene: ENSNLEG00000027007   Transcript: ENSNLET00000031716
Sequence length 251
Comment pep:novel supercontig:Nleu1.0:GL397417.1:2576097:2589476:-1 gene:ENSNLEG00000027007 transcript:ENSNLET00000031716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDDDYDEYSKELNQYRRSKDSRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMNKGGM
NDDEDFYDDDMGDGGGGGYRSRDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIE
LPKKRELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETREL
LDKMLADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPQAPTSPNGRPM
QGGPPPPPPPP
Download sequence
Identical sequences ENSNLEP00000023354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]