SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023356 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023356
Domain Number 1 Region: 200-389
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-35
Family Laminin G-like module 0.00000423
Further Details:      
 
Domain Number 2 Region: 403-603
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.86e-28
Family Laminin G-like module 0.0000412
Further Details:      
 
Domain Number 3 Region: 54-182
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000424
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023356
Domain Number - Region: 175-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000316
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023356   Gene: ENSNLEG00000001695   Transcript: ENSNLET00000032357
Sequence length 610
Comment pep:known_by_projection supercontig:Nleu1.0:GL397284.1:302501:344251:-1 gene:ENSNLEG00000001695 transcript:ENSNLET00000032357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDQVCVSTLRRLCSFLFSVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQCSPLPC
NEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPGSYHCSC
KSGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGGFECECPEGYRYNLKSKSCEDIDE
CSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELLYLAEQF
AGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWFLIALRGGKIEIQLKNE
HTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGLLETKVY
FAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLITVEKGSYYP
GSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLVDSTSEK
SQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETTSHEDLQRQLAI
LDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHNDIRAHSC
PSVWKKTKNS
Download sequence
Identical sequences ENSNLEP00000023356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]