SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023448 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023448
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.79e-68
Family TRADD, N-terminal domain 0.0000000462
Further Details:      
 
Domain Number 2 Region: 220-304
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000016
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023448   Gene: ENSNLEG00000004328   Transcript: ENSNLET00000032699
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397289.1:19812746:19817708:-1 gene:ENSNLEG00000004328 transcript:ENSNLET00000032699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQRSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAQGGDGEVASAPL
QPPVPSLSEAKPPPPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTDPNGGLA
Download sequence
Identical sequences G1QWB5
ENSNLEP00000023448 ENSNLEP00000005236 XP_003262922.1.23891 XP_012360577.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]