SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023500 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023500
Domain Number 1 Region: 116-226
Classification Level Classification E-value
Superfamily Fibronectin type III 7.81e-18
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 21-130
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000236
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023500   Gene: ENSNLEG00000011639   Transcript: ENSNLET00000031870
Sequence length 538
Comment pep:known_by_projection supercontig:Nleu1.0:GL397283.1:1166483:1220626:-1 gene:ENSNLEG00000011639 transcript:ENSNLET00000031870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKG
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFVPLYKDCSGDFKKWVGAPFTGSS
LELGSWSPEVPSTLEVYSCHPPQSAAKRLQLTELQEPAELVESDGVPKPSFWPTVQSLGG
SAYSEERDRPYGLVSIDTVTVRDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLG
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PPAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
Download sequence
Identical sequences G1RLR5
XP_003261598.1.23891 XP_003261600.1.23891 ENSNLEP00000014175 ENSNLEP00000023500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]