SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023518 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000023518
Domain Number - Region: 60-118
Classification Level Classification E-value
Superfamily EF-hand 0.00289
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023518   Gene: ENSNLEG00000026911   Transcript: ENSNLET00000031890
Sequence length 168
Comment pep:novel contig::ADFV01139687.1:1942:7063:1 gene:ENSNLEG00000026911 transcript:ENSNLET00000031890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNPYPPALPAITTQGPELGLCASLPQLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYR
LLVSQRRPTGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAA
LKWKAKKNREHWFDELPRTALLIFKGINILVKSKAFQYFMCKCEISPF
Download sequence
Identical sequences ENSNLEP00000023518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]