SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023543 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023543
Domain Number 1 Region: 297-452
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.68e-32
Family AlaX-like 0.026
Further Details:      
 
Domain Number 2 Region: 47-198
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.05e-17
Family Co-chaperone p23-like 0.00031
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000314
Family AlaX-M N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023543   Gene: ENSNLEG00000011890   Transcript: ENSNLET00000031918
Sequence length 612
Comment pep:novel supercontig:Nleu1.0:GL397460.1:1880487:1909790:-1 gene:ENSNLEG00000011890 transcript:ENSNLET00000031918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYV
FMEFCVEDSTDVHVLIEDHRIVFSSGPAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWE
GDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDFTTTVVSCRPAELQTEGSNGKKEVLSG
FQVVLEDTLLFPEGGGQPDDRGTINDISVLRVTRHGEQADHFTQTPLDPGSQVLVQVDWE
RRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFQSAIELDTPSMTAEQVAAIEQNVNE
KIRDRLPVNVRELSLDDPEVEQVRGRGLPDDHAGPIRVVSIEGVDSNMCCGTHVSNLSDL
QVIKILSTEKGKKNKTNLIFLAGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQN
STKILQKNNLNLLRDLAVHIAHSLRNSPDWGGVVVLHRKEGDSEFMNIIANEIGSEETLL
FLTVGDEKGAGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRTEAQAL
LQDYISMQSAKE
Download sequence
Identical sequences ENSNLEP00000023543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]