SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023552 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023552
Domain Number 1 Region: 115-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000475
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023552
Domain Number - Region: 60-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0029
Family V set domains (antibody variable domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023552   Gene: ENSNLEG00000013683   Transcript: ENSNLET00000031927
Sequence length 307
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:11139049:11168673:-1 gene:ENSNLEG00000013683 transcript:ENSNLET00000031927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGP
PRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKV
LNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYI
CTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTDH
YQTTMEKKSLTIYAQVQKPGPLQKKLDPFPAQDPCTTIYVAATEPVPESVQETNSITVYA
SVTLPES
Download sequence
Identical sequences XP_012366484.1.23891 ENSNLEP00000023552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]