SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023561 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023561
Domain Number 1 Region: 338-436
Classification Level Classification E-value
Superfamily Immunoglobulin 6.2e-28
Family I set domains 0.00046
Further Details:      
 
Domain Number 2 Region: 43-135
Classification Level Classification E-value
Superfamily Immunoglobulin 3.47e-24
Family I set domains 0.0000205
Further Details:      
 
Domain Number 3 Region: 239-335
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-24
Family I set domains 0.0009
Further Details:      
 
Domain Number 4 Region: 136-236
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-23
Family I set domains 0.00000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023561   Gene: ENSNLEG00000026929   Transcript: ENSNLET00000031934
Sequence length 484
Comment pep:novel supercontig:Nleu1.0:GL397560.1:168930:175445:1 gene:ENSNLEG00000026929 transcript:ENSNLET00000031934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRGLIHPQSRAVGRDAMTTILMVLICLGLSLGPRTHVQAETLPKPTLWAEPGSVITQGS
PLTLRCQGGLKAQEYHLYREKKLASWITRIQPELVKKGRFHIPSVTWEHTGRYRCQYHSH
TQSEPSDPLELVVTGVYNRPTLSALPSPVVTSGGNVTLQCVSQLAFDGFILCKEGEDEHP
QCLNSQPRTRGWSWAVFSVGPVSPSRRWSYRCYGYDSRSPYVWSSPSDLLELLVPGVSKK
PSLSVQPGPVMAPGEELTLQCGSDVGYDRFALYKEGERDFLQRPGRQPQAGLSQANFTLS
PVIRSHGGQYRCSGAHNLSSEWSAPSDPLDILITGQIPDRPSLSVQPGPTLASGENVTLL
CQSRGRMDTFLLTKDGAAHHPLRLRSEHRAQQHQAEFPMSPVTSAHAGTYRCYGSLSSKP
YLLTHPSDPLELVVSGAAETLSPPQNKSDSKADPELPECRKTPSPNASGATSGCAEHKKS
EIIQ
Download sequence
Identical sequences ENSNLEP00000023561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]