SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023574 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000023574
Domain Number - Region: 34-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000653
Family I set domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023574   Gene: ENSNLEG00000007065   Transcript: ENSNLET00000031946
Sequence length 209
Comment pep:known_by_projection supercontig:Nleu1.0:GL397263.1:48176343:48200201:1 gene:ENSNLEG00000007065 transcript:ENSNLET00000031946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSGLWYFFLFCLHIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCIFGCVLICWLTKKKYSSSMHDPNGEY
MFMRAVNTAKKSRLTGMTPFGGLGREEVS
Download sequence
Identical sequences ENSNLEP00000023574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]