SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023585 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023585
Domain Number 1 Region: 42-194
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-32
Family C-type lectin domain 0.0000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023585   Gene: ENSNLEG00000002956   Transcript: ENSNLET00000031957
Sequence length 197
Comment pep:known_by_projection supercontig:Nleu1.0:GL397301.1:1357706:1386784:1 gene:ENSNLEG00000002956 transcript:ENSNLET00000031957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGGKMHDSNNVEKDIAPSELPANPGYLHSKEHSIKATLIWPLFFLIMFLTIIVCGMVA
ALSAIRANCHQKPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVE
SFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSA
RHYTERKWICSKSDIHV
Download sequence
Identical sequences ENSNLEP00000023585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]