SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023620 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023620
Domain Number 1 Region: 138-331
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000157
Further Details:      
 
Domain Number 2 Region: 11-104
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.37e-20
Family CRAL/TRIO domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023620   Gene: ENSNLEG00000026573   Transcript: ENSNLET00000031991
Sequence length 383
Comment pep:novel supercontig:Nleu1.0:GL397568.1:468688:527390:1 gene:ENSNLEG00000026573 transcript:ENSNLET00000031991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYFLNGYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYV
VHPTSFIKVLWNILKPLISHKFGKKVTYFNYLSELHEHLKYDQLIIPPEVVRYDEKLQSL
HEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGL
FRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILR
ITCVESSLRVTRCRQILWSLPEHNYVVLRYLVGFLHAVSRESIFNKMNSSNLACVFGLNL
IWPSQGASSLSALVPLNMFTELLIEYYEKIFSAPEAPGEHSLAPWERGSRAAPLQEAVPQ
TQATGLTKPTIPPSPLMVARRRL
Download sequence
Identical sequences ENSNLEP00000023620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]