SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023655 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023655
Domain Number 1 Region: 420-583
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.27e-23
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 265-368
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000118
Family I set domains 0.00000221
Further Details:      
 
Domain Number 3 Region: 177-248
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000146
Family I set domains 0.0000137
Further Details:      
 
Domain Number 4 Region: 84-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000196
Family I set domains 0.0000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023655   Gene: ENSNLEG00000014597   Transcript: ENSNLET00000032215
Sequence length 609
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:3893331:3919349:1 gene:ENSNLEG00000014597 transcript:ENSNLET00000032215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSSAVAKLSSISTPSRPCCPFSLHCHRIFKFLLSARENMKVLLRLICFIALLISSLEA
DKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQTSRIHQHKEK
LWFVPAKVEDSGHYYCVVRNSSYCFRIKTTAKFVENEPNLCYNAQAIFKQKLPVAGDGGL
VCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASY
TYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYW
KWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI
DAAYIQLIYPVTNFQKQMIGICVTLTVIIVCSLFIYKIFKIDIVLWYRDSCYDFLPIKAS
DGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVI
NENVKKSRRLIIILVREISGFSWLGGSSEEQIAMYNALVHDGIKVVLLELEKIQDYEKMP
ESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL
QREAHMPLG
Download sequence
Identical sequences ENSNLEP00000023655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]