SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023679 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023679
Domain Number 1 Region: 158-270
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000119
Family Fibronectin type III 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023679
Domain Number - Region: 66-168
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0103
Family Fibronectin type III 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023679   Gene: ENSNLEG00000014552   Transcript: ENSNLET00000032054
Sequence length 530
Comment pep:known_by_projection supercontig:Nleu1.0:GL397458.1:2127705:2139540:1 gene:ENSNLEG00000014552 transcript:ENSNLET00000032054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPVVPGCTLHSRKRPSAQSLAGWTLESEALRRDMGTWLLACTCICTCVCSGVSVTGEG
QGPRARTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVL
PPEAVLVPSDNFTITFHHCMSGREQVSLVDPEYLPRRHVKLDPPSDLQSNVSSGHCILTW
SISPALEPMTTLLSYELAFKKQEEAWEHAQHRDHIVGVTWLILEAFELHPGFIHEARLRV
QMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPLGWPDNTLVAVSVFLLLIGL
TYLLFKLSPRVKRIFYQNVPSPAVFFQPLYGVHNGNFQTWMGAHRAGVLLSQDCAGTPRG
ALEPCVQEATALLTCGPAHPWKSVALEEEQECPGTRLSGNLCSEDVLPAGCTEWRVQTLA
YLPQEDWAPTSLTRPAPPDSEGSSSSSSSSNYCALGCYGGWHLSALPGNTQSPGPIPALA
GSLSCDHQGLETQPGVAWVLDGHCQRPGLHEDLQGMLLPSVLSKARSWTF
Download sequence
Identical sequences ENSNLEP00000023679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]