SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023705 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023705
Domain Number 1 Region: 115-177
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.000048
Further Details:      
 
Domain Number 2 Region: 14-109
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000109
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023705
Domain Number - Region: 200-253
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0209
Family C-terminal domain of PLC-beta 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023705   Gene: ENSNLEG00000009190   Transcript: ENSNLET00000032080
Sequence length 302
Comment pep:known_by_projection supercontig:Nleu1.0:GL397339.1:6884268:6893981:-1 gene:ENSNLEG00000009190 transcript:ENSNLET00000032080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSASMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGVHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSCRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEEKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLVSRTRRVCVGSVQLCSSKVQVML
LH
Download sequence
Identical sequences ENSNLEP00000023705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]