SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023706 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023706
Domain Number 1 Region: 678-943
Classification Level Classification E-value
Superfamily RNI-like 5.97e-61
Family 28-residue LRR 0.0024
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 2.26e-18
Family Caspase recruitment domain, CARD 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023706
Domain Number - Region: 190-292
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000879
Family G proteins 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023706   Gene: ENSNLEG00000015142   Transcript: ENSNLET00000032480
Sequence length 953
Comment pep:known_by_projection supercontig:Nleu1.0:GL397330.1:10387792:10417208:-1 gene:ENSNLEG00000015142 transcript:ENSNLET00000032480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQGYSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYSQQLRHHLGSDSKFVLCYAQKEELLLEEIYMDSIMELVGFSNESLGSLDSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKQSDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGVEIPCQFLRKKVLLRGFSPSHLRAY
ARRMFPQRALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFCAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLRAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQEGDMQLGFLRALPELGPGRDQQSYEFFHLTLQAFFTALFLVLDDRVGTQEL
LRFFQEWMPPGGAATASCYPPFLPFQCLRGSVLAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFLWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLYHFSKRLALDLDNNNLNDYGV
RELRPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKCLALAVKNSKSISDVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGVSTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
Download sequence
Identical sequences G1RYR7
XP_003270528.1.23891 XP_012352432.1.23891 ENSNLEP00000018394 ENSNLEP00000023706 ENSNLEP00000018394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]