SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023715 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023715
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Immunoglobulin 9.57e-19
Family I set domains 0.029
Further Details:      
 
Domain Number 2 Region: 7-54
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000214
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023715   Gene: ENSNLEG00000026829   Transcript: ENSNLET00000032090
Sequence length 220
Comment pep:novel supercontig:Nleu1.0:GL399051.1:1230:13336:1 gene:ENSNLEG00000026829 transcript:ENSNLET00000032090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVWHGLLPSGSLRLAQVQVGDSGHYECTASNPAGSASRRYILGVQVPPQVQPGPRVLKVL
VGEALDLNCVAEGNPEPQLSWSKDGVDLQGRGPEGSVHFAAIRTSDAGRYRCEASNSAGV
DAWEVELRVLGESPWPQNLLLPSSPSHRLDMGGALLCSGLCACPFPSFLGQIEPWPFLGP
SSPTALGLSCVQEPLSALGYGPGGPQSSQQGFPVLLTLGR
Download sequence
Identical sequences ENSNLEP00000023715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]