SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023731 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023731
Domain Number 1 Region: 65-442
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.02e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023731   Gene: ENSNLEG00000011936   Transcript: ENSNLET00000032079
Sequence length 473
Comment pep:known_by_projection supercontig:Nleu1.0:GL397325.1:924647:980253:-1 gene:ENSNLEG00000011936 transcript:ENSNLET00000032079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPRALSAGAGQSWRRAARAYRGFPLLLPEPAALTRTLSRAMACRQEPQPQGPPPAAD
AVASYDYLVIGGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHS
EFMHDHADYGFTSCEGKFDWRVIKEKRDAYVSRLNTIYQNNLTKSHIEIIRGHAAFTSDP
KPTIEVSGKKYTAPHILIATGGVPSTPHESEIPGASLGITSDGFFQLEELPSRSVIVGAG
YIAVEIAGILSALGSKTSLLIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVTEVKK
TLSGLEVSMVTAVPGRLPVMTVIPDVDCLLWAIGRDPNSKGLSLDKLGIQTDDKGHIIVD
EFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP
IGTVGLTEDEAIHKYGKENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEK
Download sequence
Identical sequences ENSNLEP00000023731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]