SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023773 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023773
Domain Number 1 Region: 61-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000716
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023773   Gene: ENSNLEG00000016563   Transcript: ENSNLET00000032151
Sequence length 360
Comment pep:known_by_projection supercontig:Nleu1.0:GL397398.1:2456640:2464211:1 gene:ENSNLEG00000016563 transcript:ENSNLET00000032151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLHCCLFTLVASIIVPAAFVLEDVDFNQMVSLEANRSSYNASFPSSFELSASSHSDDDV
IIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRGRGGKWLVSDNFLNITNVAFDDRG
LYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKT
EKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVP
LPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDS
DDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNYKDGAYENCQL
Download sequence
Identical sequences G1S3J9
ENSNLEP00000020087 ENSNLEP00000020087 ENSNLEP00000023773 XP_003276609.1.23891 XP_003276610.1.23891 XP_003276611.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]