SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023776 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023776
Domain Number 1 Region: 56-140
Classification Level Classification E-value
Superfamily RING/U-box 9.89e-16
Family RING finger domain, C3HC4 0.00019
Further Details:      
 
Domain Number 2 Region: 219-258
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000141
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Domain Number 3 Region: 133-198
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000503
Family IBR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023776   Gene: ENSNLEG00000001700   Transcript: ENSNLET00000032154
Sequence length 333
Comment pep:known_by_projection supercontig:Nleu1.0:GL397291.1:9260622:9382496:1 gene:ENSNLEG00000001700 transcript:ENSNLET00000032154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWFSRTMHTRKCAKLHMYGLRRLKNAEDRLMGSAGRLHYLAMTAENPTPGDLAPAPLITC
KLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAE
IACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHL
KFCSCCKDAWHAEISCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMM
CKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIAL
VTSPLLLLASPCIICCVCKSCRGKKKKHDPSTT
Download sequence
Identical sequences ENSNLEP00000023776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]