SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023790 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023790
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily vWA-like 1.52e-38
Family Integrin A (or I) domain 0.00067
Further Details:      
 
Domain Number 2 Region: 299-386
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000427
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 179-266
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000476
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023790   Gene: ENSNLEG00000000929   Transcript: ENSNLET00000032172
Sequence length 408
Comment pep:known_by_projection supercontig:Nleu1.0:GL398410.1:7983:14546:1 gene:ENSNLEG00000000929 transcript:ENSNLET00000032172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLDSSASVSHYEFSRVREFVGQLVAPLPLGTGALRASLVHVGSRPYTEFPFGQHSSGK
AAQDAVRASAQRMGDTHTGLALVYAKEQLFAEASGARPGVPKVLVWVTDGGSSDPVGPPM
QELKDLGVTVFIVSTGRGNFLELSAAASAPAEKHLHFVDVDDLHIIVQELRGFILDAMRP
QQLHATEITSSGFRLAWPPLLTADSGYYVLELVPSAQPGAARRQQLPGNATDWTWAGLDP
DTDYDVALVPESNVRLLRPQNLRVRTRPREAGPGASGPESGAGPAPTQLAALPAPEEAGP
ERIVISHARPRSLRVSWAPALGSAAALGYHVQFGPLGGGAAQRVEVPAGRNCTTLQGLAP
GTAYLVTVTVAFRSGRESALSAKACTPDGPRPRPVPRAPTPGTTSREP
Download sequence
Identical sequences ENSNLEP00000023790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]