SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023825 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023825
Domain Number 1 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-31
Family Spermadhesin, CUB domain 0.0000874
Further Details:      
 
Domain Number 2 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.0000387
Further Details:      
 
Domain Number 3 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000029
Family EGF-type module 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023825
Domain Number - Region: 307-347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00208
Family Complement control module/SCR domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023825   Gene: ENSNLEG00000026861   Transcript: ENSNLET00000032203
Sequence length 362
Comment pep:known_by_projection supercontig:Nleu1.0:GL397358.1:7030882:7035665:-1 gene:ENSNLEG00000026861 transcript:ENSNLET00000032203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLIF
QHFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNLPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDVDECASQSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQKDRHSCQAECSSELYTEASGYIASLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEVRAQGRGERAGPAS
QE
Download sequence
Identical sequences ENSNLEP00000023825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]