SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023842 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023842
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 2 Region: 311-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000363
Family FAD/NAD-linked reductases, N-terminal and central domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023842   Gene: ENSNLEG00000015167   Transcript: ENSNLET00000032222
Sequence length 558
Comment pep:known_by_projection supercontig:Nleu1.0:GL397275.1:21686480:21713477:1 gene:ENSNLEG00000015167 transcript:ENSNLET00000032222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSTDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKHPDFS
ATGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC
SFIAQLLPSRFLNWIQERKLNKKFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
SVMEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKHVFPVNL
ERATLAIIGLISLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLVGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASFLLICKSSLFLKLV
RDKLQDRMSPYLVSLWRG
Download sequence
Identical sequences G1RYU9
ENSNLEP00000018426 XP_003258920.1.23891 ENSNLEP00000018426 ENSNLEP00000023842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]