SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023844 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023844
Domain Number 1 Region: 41-140
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000023
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000189
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 3 Region: 700-813
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000615
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 
Domain Number 4 Region: 440-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000868
Family I set domains 0.072
Further Details:      
 
Domain Number 5 Region: 838-948
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000506
Family V set domains (antibody variable domain-like) 0.034
Further Details:      
 
Domain Number 6 Region: 574-667
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000109
Family V set domains (antibody variable domain-like) 0.068
Further Details:      
 
Domain Number 7 Region: 310-399
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000228
Family V set domains (antibody variable domain-like) 0.055
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023844
Domain Number - Region: 977-1014,1050-1113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000203
Family C1 set domains (antibody constant domain-like) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023844   Gene: ENSNLEG00000005162   Transcript: ENSNLET00000032224
Sequence length 1131
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:11996156:12147882:-1 gene:ENSNLEG00000005162 transcript:ENSNLET00000032224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNGIEIQSMLREQKWNLSSTGLNEKATVTEEIGVVSAQRQVTVQEGPLYRTEGSHITIW
CNVSGYQGPSEQNFQWSIYLPSSPEREVQIVSTMDSSFPYAIYTQRVRGGKIFIERVEGN
STLLHITDLQARDAGEYECHTPSTDKQYFGSYSAKMNLVVIPDSLQTTAMPQTLHRVEQD
PLELTCEVASETVQHSHLSVAWLRQKVGEKPVEVISLSRDFMLHSGSEYAQRQSLGEVRL
DKLGRTTFRLTIFHLQPSDQGEFYCEAAEWIQDPDGSWYAMTRKRSEGAVVNVQPTDKEF
TVRLETEKRLHTVGEPVEFRCILEAQNVPDRYFAVSWAFNSSLIATMGPNAVPVLNSEFA
HREARGQLKVAKESDSVFVLKIYHLRQEDSGKYNCRVTEREKTVTGEFIDKESKRPKNIP
IIVLPLKSSISVEVASNASVILEGEDLRFSCSVRTAGRPQGRFSVIWQLVDRQNRRSNIM
WLDRDGTVQPGSSYWERSSFGGIQMEQVQPNSFSLGIFNSRKEDEGQYECHVTEWVRAVD
GEWQIVGERRASTPISITALEMGFAVTAISRTPGVTYSDSFDLQCIIKPHYPARVPVSVT
WRFQPVGTVEFHDLVTFTRDGGVQWGDRSSSFRTRTAIEKAESSNNVRLSISRASDTEAG
KYQCVAELWRKNHNNTWTRLAERTSNLLEIRVLQPVTKLQVSKSKRTLTLVENKPIQLNC
SVKSQTSQNSHFAVLWYVHKPSDADGKLILKTTHNSAFEYGTYAEEEGLRARLQFERHVS
GGLFSLTVQRAEVSDSGSYYCHVEEWLLSPNYAWYKLAEEVSGRTEVTVKQPDSRLRLSQ
AQGNLSVLETRQVQLECVVLNRTSITSQLMVEWFVWKPNHPERETVARLSRDATFHYGEQ
AAKNNLKGRLHLESPSPGVYRLFIQNVAVQDSGTYSCHVEEWLPSPSGMWYKRAEGTAGQ
TALTVMRPDASLQVDTVVPNATVSEKAAFQLDCSIVSRSSQDSRFAVAWYSLRTKAGGKR
SSPGLEGQEENSEEEEEVEEEDEEEDDDDPTERTALLSVGPDAVFGPEGSPWEGRLRFQR
LSPVLYRLTVLQASPRDTGNYSCHVEEWLPSPQKEWDYRRPPLRPANFCIF
Download sequence
Identical sequences ENSNLEP00000023844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]