SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023872 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023872
Domain Number 1 Region: 442-606
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.23e-25
Family Toll/Interleukin receptor TIR domain 0.00092
Further Details:      
 
Domain Number 2 Region: 254-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000076
Family I set domains 0.03
Further Details:      
 
Domain Number 3 Region: 163-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000118
Family I set domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023872
Domain Number - Region: 77-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.019
Family I set domains 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023872   Gene: ENSNLEG00000014668   Transcript: ENSNLET00000032249
Sequence length 642
Comment pep:known_by_projection supercontig:Nleu1.0:GL397368.1:4156135:4190158:1 gene:ENSNLEG00000014668 transcript:ENSNLET00000032249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLGWIFLWLVTGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPTQVPEPLPFTGSKDLSDVQWCRQPSNGDPVEDIRKSYPHVIQDKCTLRFLTPRVNN
SGSYICRPKMIKSPCDVACCVKMILEVKPQTNASCENSASHKQDLLLGSTGSISCPSLSC
QSDAQSPEVTWYKNGKLLSVQRSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVESTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTHRDLRRKFVCFVQNSIGNTTQSVQLKEKRGEDM
MDSCSDEWRMEERRSNLVHCSKWCVYITDILKKKAGVEILVVLLYILLGTIGTLVAVLAA
CALLYRHWIEIVLLYRTYQSKDETLGDKKDFDAFVSYAKWSSFPSEATSSLSEEHLALSL
FPDVLENKYGYTLCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGPSIFELQAA
VNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFWTKMRY
HMPVKNSQGFTWNHLRITSRIFQWKGLSRTETTGRSSQPKGW
Download sequence
Identical sequences ENSNLEP00000023872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]