SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023889 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023889
Domain Number 1 Region: 253-349
Classification Level Classification E-value
Superfamily Immunoglobulin 2.33e-28
Family I set domains 0.00043
Further Details:      
 
Domain Number 2 Region: 50-149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-23
Family I set domains 0.00000871
Further Details:      
 
Domain Number 3 Region: 152-248
Classification Level Classification E-value
Superfamily Immunoglobulin 3.7e-23
Family I set domains 0.00098
Further Details:      
 
Domain Number 4 Region: 6-48
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000967
Family I set domains 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023889   Gene: ENSNLEG00000006319   Transcript: ENSNLET00000032267
Sequence length 391
Comment pep:novel supercontig:Nleu1.0:GL397276.1:37087946:37090864:-1 gene:ENSNLEG00000006319 transcript:ENSNLET00000032267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQELVKKGQFPIPSVTWEHAGRYRCFYGSHTAGWSELSDPLELVVTGAHSKPTLSALPS
PVVTSGENVTLQCGSQLAFDGFILCKEGEDEHPQCLNSQPRTRGWSWAVFSVGPVSPSRR
WSYRCYAYDSRSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGEKLTLQCGSDVGY
DRFTLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYRCSGAHNLSSEWSAPSD
PLDILITGQIRARPFLLVQPGPTVASGENVTLLCQSQGRMHTFLLTKEGTADPLLRLRSK
RQSHKYQAEFPMGPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLEIVVSGEGTDPVLSELK
GSAQALPQESSGTIINEGSEGGRVCRGGSSP
Download sequence
Identical sequences ENSNLEP00000023889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]