SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023948 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023948
Domain Number 1 Region: 338-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family Laminin-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 142-289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000534
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 3 Region: 239-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000023948
Domain Number - Region: 306-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023948   Gene: ENSNLEG00000017020   Transcript: ENSNLET00000032319
Sequence length 540
Comment pep:known_by_projection supercontig:Nleu1.0:GL397294.1:14605761:14718366:-1 gene:ENSNLEG00000017020 transcript:ENSNLET00000032319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGSHGPGPEDWAPARHRPPTPGCDFSSPVPRDHPSSGDGWTRFHTFQAPLGPSLTTPPA
AERTSTTSQAPTRPEPTTFSTTTGPAPTTPVATTVPAPTTPRTPTPDLPSSSSSSSSNSS
SSVLPTPPATEAPSSPPPEYVCNCSVVGSLDVNRCSQTTGQCECRPGYQGLHCETCKEGF
YLNYTSGLCQPCDCSPHGALSILCNSSGKCQCKVGVIGSTCDRCQDGYYGFSKNGCLPCQ
CNNRSASCDALTGACLNCQENSKGNHCEECKEGFYQSPDATKECLRCPCSAVTSTGSCSI
KSSELEPECDECKDGYIGPNCNKCENGYYNFDSICRKCQCHGHVDPVKTPKICKPESGEC
INCLHNTTGFWCENCLEGYVQDLEGNCIKKEVIVPTPEGSTILVSNASLTTSVPTPVINS
TFTPTTLQTIFSVSTSENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQ
NRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPIHNYKA
Download sequence
Identical sequences ENSNLEP00000023948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]