SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023950 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023950
Domain Number 1 Region: 485-611
Classification Level Classification E-value
Superfamily Cadherin-like 4e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 233-355
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 123-246
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-20
Family Cadherin 0.0024
Further Details:      
 
Domain Number 4 Region: 603-710
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000107
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 400-489
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000414
Family Cadherin 0.0038
Further Details:      
 
Domain Number 6 Region: 29-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000186
Family Cadherin 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023950   Gene: ENSNLEG00000015818   Transcript: ENSNLET00000032321
Sequence length 973
Comment pep:known_by_projection supercontig:Nleu1.0:GL397270.1:476694:481527:-1 gene:ENSNLEG00000015818 transcript:ENSNLET00000032321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVRLWGSPCLFPLQLFSLCWVLSVAQSKTVRYSTFEEDAPGTVIGTLAEDLHMKVSGD
TSFRLMKQFNSSLLRVREGDGQLTVGDAGLDRERLCGQAPQCVLAFDVVSFSQEQFRLVH
VEVEVRDVNDHAPRFPRAQIPVEVSEGAAVGTRIPLEVPVDEDVGANGLQTVRLAEPHSP
FRVELQTRADGAQCADLVLLQELDRESQAAYSLELVAQDGGRPPRSATAALSVRVLDAND
HSPAFPQGAVAEVELAEDAPVGSLLLDLDAADPDEGPNGDVVFAFGARTPPEARRLFRLD
PRSGRLTLAGPVDYERQDTYELDVRAQDRGPGPRAATCKVIVRIRDVNDNAPDIAITPLA
APGAPAASPFAAAAAAAALGGADASSPAGAGTPEAGATSLVPEGAARESLVALVSTSDRD
SGANGQVRCALYGHEHFRLQPAYAGSYLVVTAASLDRERIAEYNLTLVAEDRGAPPLRTV
RPYTVRVGDENDNAPLFTRPVYEVSVRENNPPGAYLATVAARDRDLGRNGQVTYRLLEAE
VGRAGGAVSTYVSVDPATGAIYALRSFDYETLRQLDVRIQASDGGSPQLSSSALVQVRVL
DQNDHAPVLVHPEPANGSLEVAVPGRTAKDTVVARVQARDADEGANGELAFELQQQEPRE
AFAIGRRTGEILLTGDLSQEPPGRVFRALLVISDGGRPPLTTTATVSFVVTPGGGRGPAA
PASAGSPERSRPPGSRLGASGSALQWDTPLIVIIVLAGSCTLLLAAIIAIATTCNRRKKE
PYGASPGFGKEPAPPVAVWKGHSFNTISGREAEKFSGKDSGKGDSDFNDSDSDISGDALK
KDLINHMQSGLWACTAECKILGHSDRCWSPSCSGPNAHPSPHPPAQMSTFCKSTSLPRDP
LRRDNYYQAQLPKTVGLQSVYEKVLHRDYDRTVTLLSPPRPGRLPDLQEIGVPLYQSPPG
RYLSPKKGANENV
Download sequence
Identical sequences ENSNLEP00000023950 XP_003257400.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]