SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000023961 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000023961
Domain Number 1 Region: 336-434
Classification Level Classification E-value
Superfamily Immunoglobulin 5.45e-27
Family I set domains 0.00073
Further Details:      
 
Domain Number 2 Region: 42-136
Classification Level Classification E-value
Superfamily Immunoglobulin 7.6e-25
Family I set domains 0.0000191
Further Details:      
 
Domain Number 3 Region: 237-333
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-24
Family I set domains 0.00045
Further Details:      
 
Domain Number 4 Region: 140-234
Classification Level Classification E-value
Superfamily Immunoglobulin 1.51e-23
Family I set domains 0.00000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000023961   Gene: ENSNLEG00000026717   Transcript: ENSNLET00000032332
Sequence length 469
Comment pep:novel supercontig:Nleu1.0:GL397560.1:205715:208916:1 gene:ENSNLEG00000026717 transcript:ENSNLET00000032332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRGLIHPQSRAVGGDAMTPILTVLICLGLSLGPRTHVQAGPLPKPTLWAQPGSVITQGS
PVTLRCQGDLKAQEYRLYREKKLASWITWIRPELVKKGQFPIPSITWEHAGRYRCEYHSR
TRWSEPSDPLELVMTGVYIKPTLSAQPSPVVASGGNVTLQCVSQVAFDGFILCKEGEDEH
PQCLNHARGWSWAVFSVGPVSPSRRWSYRCYAYDSRSPYVWSSPSDLLELLVPGVSKKPS
LSVQPGPVMAPGESLTLQCGSDVGYDRFALYKEGERNFLQCPGRQPQAGLSQANFTLGPV
SRSYGGQYRCSGAHSLSSEWSAPSDPLDILITGQIPDRPSLSVQPGPMVASGANVTLLCQ
SRGRMDTFLLTKDGAAHHPLRLRSEHQAQQHKAEFLMSPVTSAHAGTYRCYGSLSSKPYL
LTHPSDPLELVFSGPSGGPSSPTTGPTSTSGESLRLLDSEGVRPPTGQP
Download sequence
Identical sequences ENSNLEP00000023961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]