SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024013 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000024013
Domain Number - Region: 71-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00806
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024013   Gene: ENSNLEG00000026669   Transcript: ENSNLET00000032379
Sequence length 338
Comment pep:novel supercontig:Nleu1.0:GL397274.1:5528666:5529682:1 gene:ENSNLEG00000026669 transcript:ENSNLET00000032379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNQGKKTGNSKKQSTSPPPKERSSSPAMEQSWMEDDFDELREEGFRRSNYSELREEIQ
NNSKEVKNFEKKLEEWITRITNGEKGLKELMELKAKFRELREDCRSLRSRCNQLEERVSL
MEDEMNEMKREGKFREKRIKRNEQSLQEIWDYVKRPNLRLIGVPENDGENGTKLENTLQD
IIQENFPNLARQASIQIQEIQRTPQRYSSRRATPRHIIVRFTKVEMKEKMLRAAREKGRV
THKGKPIRLTADLSAETLQVRREWGPMFNILKEKNFQPRISYPAKLSFISKGEIKYFTDK
QMLSDFVTTRPALKELLKEALNTERKNRYQPLQKHTKL
Download sequence
Identical sequences ENSNLEP00000024013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]