SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024049 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSNLEP00000024049
Domain Number - Region: 146-320
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00245
Family Spectrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024049   Gene: ENSNLEG00000026664   Transcript: ENSNLET00000032421
Sequence length 547
Comment pep:novel supercontig:Nleu1.0:GL397434.1:1285801:1319513:-1 gene:ENSNLEG00000026664 transcript:ENSNLET00000032421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDEFDQFIRKSLNFLMDNMVIDESIAPLFEVRMELDEDGLTFNPSLEVGSDRGFLALI
EGLVSDIYNVARLIPRLAKDRMSYKMDLEDNTDLIEMREEVSSLVINAMKEAEEYQDSFE
RYSYLWMDNLQEFMKNFLIYGCTVTVEDLDTRTDDTIPKTPPTLAQFQEQIDSYEKLYEE
VSKYENTKVFHGWLRCDCRPFKQALLSTIRRWGFMLKQHLSNHVTNSLADLEAFMKVARM
GLTKPLKEGDYDGLVEVMGHLMKVKERQAATDNMFEPLKQTIELLKTYGEEMPEEVHLKL
QELPEHWTNTKKLAIQVKQNVAPLQANEVSILRRKCQQFELKQHEFRERFRREAPFSFRD
PNPYKSLNKQQKSISAMEGIMDALSKSGGLFEVTVPDYKQLKACHREVRLLKELWDVIVV
VNTSIEDWKTTKWKDINVEQMDIDCKKFAKDVRSLDKEMKTWDAFVGLDNTVKNMITCLR
AVSELQNPAIRERHWQQLMQATQVKFKMSEETTLADLLQLNLHSYEDEVRNIVDKAVKES
GMEKVGR
Download sequence
Identical sequences ENSNLEP00000024049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]