SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024069 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024069
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.41e-18
Family THAP domain 0.00068
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000024069
Domain Number - Region: 153-201
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0144
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024069   Gene: ENSNLEG00000007973   Transcript: ENSNLET00000032441
Sequence length 222
Comment pep:known_by_projection supercontig:Nleu1.0:GL397302.1:7191565:7206831:1 gene:ENSNLEG00000007973 transcript:ENSNLET00000032441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCCSAVGCASRCLPNSKLKGLTFHVFPTDENIKRKWVLAMKRLDVNAAGIWEPKKGDV
LCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNH
HLVGASSCIEEFQSQFIFEHSYSVMDSPKKLKHKLDHVIGELEDTKESLRNVLDREKRFQ
KSLRKTIRELKDECLISQETANRLDAFCWECCQESIEQDYIS
Download sequence
Identical sequences A0A2I3I0E4
XP_003265803.1.23891 XP_003265804.1.23891 XP_012355021.1.23891 ENSNLEP00000009723 ENSNLEP00000009723 ENSNLEP00000024069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]