SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024076 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024076
Domain Number 1 Region: 316-552
Classification Level Classification E-value
Superfamily Caspase-like 2.84e-39
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 28-138
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-23
Family DEATH domain, DD 0.0044
Further Details:      
 
Domain Number 3 Region: 127-213
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000012
Family I set domains 0.047
Further Details:      
 
Domain Number 4 Region: 225-308
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000892
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024076   Gene: ENSNLEG00000008289   Transcript: ENSNLET00000032450
Sequence length 813
Comment pep:known_by_projection supercontig:Nleu1.0:GL397295.1:4200762:4272932:1 gene:ENSNLEG00000008289 transcript:ENSNLET00000032450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLGDPLEALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSERLDQAPEGRGWRRLAEL
AGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQ
LLSPPGIKITINPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAV
HVKDAGFYVCRVNNNFTFEFSQWSQLDVCDVPESFRRSVDGVSESKLQICVEPTSQKLMP
GSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGTYWCHVYNDRDSQD
SKKVEIIIDELNNLGHPDNKEQTTDQPLAKDKVALLIGNMNYREHPKLKAPLVDVYELTN
LLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGLLYYAGHGYENFGNSFMVPVDAP
NPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYA
TCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGKQALEIR
SSLSEKRALTDPIQGTEYSAESLVRNLQWAKAHELPESMCLKFDCGVQIQLGFAAEFSNV
MIIYTSIVYKPPEIIMCDAYVTDFPLDLDIDPKDANKGTPEETGSYLVSKDLPKHCLYTR
LSSLQKLKEHLVFTVCLSYQYSGLEDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCL
MSNGPYQSSAATSGGAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCRCSRTPDAFISSFA
HHSSCHFSRSNVPVETTDEIPFSFSDRLRISEK
Download sequence
Identical sequences A0A2I3HM91
XP_003264326.1.23891 ENSNLEP00000024076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]