SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024081 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024081
Domain Number 1 Region: 104-288
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-60
Family SPRY domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 19-92
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000217
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024081   Gene: ENSNLEG00000027011   Transcript: ENSNLET00000032455
Sequence length 304
Comment pep:novel contig::ADFV01141398.1:6711:8815:-1 gene:ENSNLEG00000027011 transcript:ENSNLET00000032455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILIPRSFFFLQTFAMAQHFKQVIRCPVCLKDLEDAVQLKCGYVCCLPCLNSLQKEPDG
EGLLCRCCSVVSQKNDIKPKYKLRAMVSIIKELEPKLKRILTMNPRMRKFQVDMTLDVDT
ANNYLIISEDLRSVRSGDSSQNRKEQAERFDTALCVLGAPRFTSGRHYWEVDVGTSKIWD
VGICKESVNRQGQIVLSSEQGFLTVGCRNGNIFAASTMPMTPLWVSPQLHRVGIFLDVGM
RSISFFHVGDGSHIYTFSKIPDCEPWRPFFAQKRGTQDDQSILSICSVSNAASAGAPVDS
GERK
Download sequence
Identical sequences ENSNLEP00000024081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]