SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024088 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024088
Domain Number 1 Region: 16-122
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000345
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 317-362
Classification Level Classification E-value
Superfamily RING/U-box 0.000000302
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 254-291
Classification Level Classification E-value
Superfamily SAP domain 0.0000549
Family SAP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024088   Gene: ENSNLEG00000001710   Transcript: ENSNLET00000032460
Sequence length 369
Comment pep:known_by_projection supercontig:Nleu1.0:GL397432.1:997412:1047017:-1 gene:ENSNLEG00000001710 transcript:ENSNLET00000032460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKDFIMWATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHF
ANTARKQTCLDCKKNFCMTCSSQLGNGPRLCLLCQRFRATAFQREELMKMKVKDLRDYLS
LHDISTEMCREKEELVLLVLGQQPIISQEDRTRASTLSPDFPEQQAFLTQPQSSMVPPTS
PNLPSSSAQATSVPPAQVQENQQANGHVSEDQEEPVYLESVARAPAEDETQSIDSEDSFV
PGRRASLSDLTDLEDIEGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQH
LVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYV
IRAVHVFRS
Download sequence
Identical sequences ENSNLEP00000024088 XP_012359068.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]