SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024127 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024127
Domain Number 1 Region: 86-161
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000163
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 11-63
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000223
Family I set domains 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024127   Gene: ENSNLEG00000026955   Transcript: ENSNLET00000032408
Sequence length 171
Comment pep:novel supercontig:Nleu1.0:GL397281.1:26702398:26826255:1 gene:ENSNLEG00000026955 transcript:ENSNLET00000032408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLT
VGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSI
VFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTGNHSLQYFTCK
Download sequence
Identical sequences ENSNLEP00000024127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]