SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024151 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024151
Domain Number 1 Region: 175-450
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.35e-82
Family Mitochondrial carrier 0.0000317
Further Details:      
 
Domain Number 2 Region: 32-152
Classification Level Classification E-value
Superfamily EF-hand 1.2e-25
Family Polcalcin 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024151   Gene: ENSNLEG00000001473   Transcript: ENSNLET00000032519
Sequence length 460
Comment pep:known_by_projection supercontig:Nleu1.0:GL397313.1:3761192:3828343:-1 gene:ENSNLEG00000001473 transcript:ENSNLET00000032519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTEWWTSASCRRGSGTWASPWARTPRRNKVSERMKKIEEFFSKKIFTTGDVNKDGKLDF
EEIYEVPKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDAD
GTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQ
LLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTN
VIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLA
VGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFA
KDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFQRIISK
EGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
Download sequence
Identical sequences ENSNLEP00000024151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]