SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024153 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024153
Domain Number 1 Region: 84-143
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000196
Family SIAH, seven in absentia homolog 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000024153
Domain Number - Region: 30-88
Classification Level Classification E-value
Superfamily RING/U-box 0.000124
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024153   Gene: ENSNLEG00000010782   Transcript: ENSNLET00000032521
Sequence length 311
Comment pep:known_by_projection supercontig:Nleu1.0:GL397529.1:389331:407660:-1 gene:ENSNLEG00000010782 transcript:ENSNLET00000032521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKPGAEWSTALSHLVLGVVSLHAAVSTAECTNGHLMCAGCFIHLLADARLKEEQATCP
NCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRI
GCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGY
TEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKS
KVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNI
NLRLFLFQIQK
Download sequence
Identical sequences A0A2I3GQQ6 A0A2I3SMT2
ENSNLEP00000024153 XP_012363476.1.23891 XP_012363480.1.23891 XP_016868952.1.92137 XP_016868953.1.92137 XP_016868954.1.92137 XP_016868955.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]