SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024180 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024180
Domain Number 1 Region: 230-343
Classification Level Classification E-value
Superfamily Cadherin-like 7.33e-30
Family Cadherin 0.00059
Further Details:      
 
Domain Number 2 Region: 437-560
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 337-440
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-24
Family Cadherin 0.0029
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-23
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 552-659
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 32-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000357
Family Cadherin 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024180   Gene: ENSNLEG00000026569   Transcript: ENSNLET00000032549
Sequence length 826
Comment pep:known_by_projection supercontig:Nleu1.0:GL397305.1:8856456:8880595:1 gene:ENSNLEG00000026569 transcript:ENSNLET00000032549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGAGELGRAERLPVLFLFLLPLFCPALCEQIRYRIPEEMPKGSVVGNLATDLGFSVQE
LPTRKLRVSSEKPYFTVSAETGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVS
VEIGDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSL
IVKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGDPPLSGTTELRIQVTDANDNPP
VFNRDVYRVSLRENVPLGTTVLQVSATDQDEGINSEITYSFHRTGQIFGLNSKSGEITTQ
KKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGT
LIALIKIHDQDSGENGEVNCQLQGEIPFTIISSSKNSYKLVTDGTLDREQTPEYNVTIIA
TDRGKPPLSSSISVILHISDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDPDLGLN
GQVSYSIMASDLEPLALASYVSVSPQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSA
NVSLRVLVGDQNDNAPRVLYPALSPDSSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWL
SYHVLQASEPGLFSLGLRTGEVRTARALGDRDTARQRLLVAVRDGGQPPLSATATLQLVF
ADSLQEVLPDITDRPVPTDPQAELQFYLVVALALISVLFFLAVILAIALRLRSSSSPAAW
SCFQPGLCVKSGPVVPPNYSEGTLPYSYNLCVAHTGKTEFNFLKCSEQLSSGQDILCGDS
SGALFPLCNSSESTSHPELNFLVVAIIRMGSRRRCSPIREWEAARH
Download sequence
Identical sequences ENSNLEP00000024180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]