SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024202 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024202
Domain Number 1 Region: 111-207
Classification Level Classification E-value
Superfamily Immunoglobulin 6.58e-29
Family C1 set domains (antibody constant domain-like) 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024202   Gene: ENSNLEG00000026980   Transcript: ENSNLET00000032575
Sequence length 214
Comment pep:novel supercontig:Nleu1.0:GL397509.1:417549:429297:1 gene:ENSNLEG00000026980 transcript:ENSNLET00000032575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMAAPQSGDPDLGASVGSSR
SSLQSLWGRFLFQPSPQRADPRCWPRGFWSKPQSLCYVFGTGTEVTVLGQPKAAPSVTLF
PPSSEELQANKATVVCLISDFYPGAVTVAWKADGSPIKAGVETTKPSKQSNSKYAASSYL
SLTPEQWRSHRSYSCQVTHEGSTVEKTVAPAECS
Download sequence
Identical sequences ENSNLEP00000024202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]