SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024278 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024278
Domain Number 1 Region: 263-409
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.57e-18
Family Single-domain sulfurtransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024278   Gene: ENSNLEG00000016904   Transcript: ENSNLET00000032643
Sequence length 516
Comment pep:known_by_projection supercontig:Nleu1.0:GL397279.1:5199621:5228918:-1 gene:ENSNLEG00000016904 transcript:ENSNLET00000032643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSTSPDQGDDLETCILRFSDLDLKDMSLINPSSSLKAELDGSTKKKYSFAKKKAFALF
VKTKEVPTKRSFECKEKLWKCCQQLFTDQTSIHRHVATQHADEIYHQTASILKQLAVTLS
TSKSLLSADEKNPLKECLPHTHDVSAWLPDISCFNPDELISGQGSEEGEVLLYYCYRDLE
DPQWICAWQTALCQHLHLTGKIRIAAEGINGTVGGSKLATRLYVEVMLSFPLFKDYLCKD
DFKTSKGGAHCFPELRVGVFEEIVPMGISPKKISYKKPGIHLSPGEFHKEVEKFLSQANQ
EQSDTILLDCRNFYESKIGRFQGCLAPDIRKFSYFPSYVDKNLELFREKRVLMYCTGGIR
CERGSAYLKAKGVCKEVFQLKGGIHKYLEEFPDGFYKGKLFVFDERYALSYNSDVVSECS
YCGARWDQYKLCSTPPCRQLVLTCPACQGQGFTACCVTCQDKGSRKVSGPMQDSFKEECE
CTARRPRIPRELLQHVRQPVSPEPGPDADEDGPVLV
Download sequence
Identical sequences G1S4U7
ENSNLEP00000020535 ENSNLEP00000024278 XP_003260589.1.23891 ENSNLEP00000020535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]