SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024336 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024336
Domain Number 1 Region: 132-230
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-20
Family I set domains 0.0021
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000106
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024336   Gene: ENSNLEG00000026895   Transcript: ENSNLET00000032700
Sequence length 265
Comment pep:known_by_projection supercontig:Nleu1.0:GL397521.1:174665:264803:1 gene:ENSNLEG00000026895 transcript:ENSNLET00000032700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQT
SDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVAR
NDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPL
PTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVFTR
TQGNQMELTTSALTRRATSDTSRRL
Download sequence
Identical sequences ENSNLEP00000024336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]