SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024338 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024338
Domain Number 1 Region: 15-180
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-49
Family G proteins 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024338   Gene: ENSNLEG00000011056   Transcript: ENSNLET00000032701
Sequence length 215
Comment pep:known_by_projection supercontig:Nleu1.0:GL397414.1:1796893:1809422:-1 gene:ENSNLEG00000011056 transcript:ENSNLET00000032701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAHRTPQPRAAPSQPRAFKLVLLGSGSVGKSSLALRYVKNDFKSILPTVGCAFFTKVV
DVGATSLKLEIWDTAGQEKYHSVCHLYFRGANAALLVYDITRKDSFLKAQQWLKDLEKEL
HPGEVLVMLVGNKTDLSEEREVTFQEGKEFADSQRLLFMETSAKLNQQVREVFNSVGEWR
PRGPDKGDVLVPDQLLWVPVAGDAGSHRMCLGTGW
Download sequence
Identical sequences ENSNLEP00000024338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]