SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024342 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024342
Domain Number 1 Region: 122-284
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-19
Family C-type lectin domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSNLEP00000024342
Domain Number - Region: 283-348
Classification Level Classification E-value
Superfamily FnI-like domain 0.000921
Family VWC domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024342   Gene: ENSNLEG00000005117   Transcript: ENSNLET00000032705
Sequence length 568
Comment pep:known_by_projection supercontig:Nleu1.0:GL397492.1:10972:81120:-1 gene:ENSNLEG00000005117 transcript:ENSNLET00000032705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHPLVPQSCGATLGSLRVAAAPSSASPSPGSVMAGQLARMRATKPTVQLPVSGPAPQK
LRWLFPSPPSADAPSQWLHPCIRATKVTGEARPHHGKEAVDPRQGRARGGDPTHFHAVNV
AQPVRFSSFLGKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELR
FVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFA
SAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEG
FYFTPKGDDPCLSCTCHGGEPEMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGNSLFD
SMASGMRLVVSCISSFLILSLLLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYG
PDGFGTGLTPLHLSDDGEGGTFHFHDPPPPYTAYKYPDIGQPDDPPPPYEASIHPDSVFY
DPADDDAFEPVEVSLPAPGDGGSEGALPRRLEQPLPTAGASLADLEDSADSSSALLVPPD
PAQSGSNPAAEALPGGSRHSRSSLNTMV
Download sequence
Identical sequences ENSNLEP00000024342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]