SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSNLEP00000024381 from Nomascus leucogenys 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSNLEP00000024381
Domain Number 1 Region: 2-166
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000179
Family L-arabinose binding protein-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSNLEP00000024381   Gene: ENSNLEG00000026758   Transcript: ENSNLET00000032741
Sequence length 193
Comment pep:novel supercontig:Nleu1.0:GL397441.1:1554751:1791868:-1 gene:ENSNLEG00000026758 transcript:ENSNLET00000032741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNPGGSPRTACHLNPSPDGEAYTLA
SRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNIS
HVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFINEVSHGGLRPQGPGAQGSAEDG
SGGLQGTVLLRMA
Download sequence
Identical sequences ENSNLEP00000024381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]